ELISA Recombinant Retinoic acid-induced protein 3(GPRC5A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NFJ5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFmLTLPILVCKVQDSN RRKmLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTmLLSIAIWVAWITLLmLPDFDRRW DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS Protein Names:Recommended name: Retinoic acid-induced protein 3 Alternative name(s): G-protein coupled receptor family C group 5 member A Orphan G-protein-coupling receptor PEIG-1 Retinoic acid-induced gene 1 protein Short name= RAIG-1 Gene Names:Name:GPRC5A Synonyms:GPCR5A, RAI3, RAIG1 Expression Region:1-357 Sequence Info:fµLl length protein