ELISA Recombinant Cryptococcus neoformans var. neoformans serotype D V-type proton ATPase subunit e(VMA9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) Uniprot NO.:Q5K8S8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFFHVVFVAFVIAAIGAAGWFVTPKGKNQTLLRTSLLLTLTCCYLMWAITYLCQLHPLI TPRRSDLRMEY Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e Gene Names:Name:VMA9 Ordered Locus Names:CNL04630 Expression Region:1-71 Sequence Info:fµLl length protein